AGA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179881

Catalog No. NBP179881

Description

AGA Polyclonal specifically detects AGA in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AGA
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001165459
• Gene Symbols: AGA
• Immunogen: The immunogen for this antibody is AGA. Peptide sequence SMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGI.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 86%; Bovine: 86%; Guinea pig: 85%; Dog: 79%; Rat: 79%; Horse: 79%.
• Target Species: Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AGU, aspartylglucosaminidase, aspartylglucosylamine deaspartylase, ASRG, EC 3.5.1, EC 3.5.1.26, GA, glycosylasparaginase, N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase, N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Proteases & Other Enzymes
• Gene ID (Entrez): 175
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.