Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AGA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | AGA |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179881
|
Novus Biologicals
NBP179881 |
100 μL |
Each of 1 for $436.00
|
|
Description
AGA Polyclonal specifically detects AGA in Human samples. It is validated for Western Blot.Specifications
AGA | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
AGU, aspartylglucosaminidase, aspartylglucosylamine deaspartylase, ASRG, EC 3.5.1, EC 3.5.1.26, GA, glycosylasparaginase, N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase, N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase | |
AGA | |
IgG | |
Affinity Purified | |
36 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_001165459 | |
175 | |
The immunogen for this antibody is AGA. Peptide sequence SMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title