Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AGTPBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179579

 View more versions of this product

Catalog No. NBP179579


Add to cart

Description

Description

AGTPBP1 Polyclonal antibody specifically detects AGTPBP1 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

AGTPBP1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
AGTPBP1
Synthetic peptide directed towards the N terminal of human AGTPBP1The immunogen for this antibody is AGTPBP1 (NP_056054). Peptide Sequence: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI
134 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Zebrafish: 86%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 0.2-1 ug/ml
Q9UPW5
ATP/GTP binding protein 1, ATP/GTP-binding protein 1, CCP1, DKFZp686M20191, EC 3.4.17, EC 3.4.17.-, KIAA1035NNA1cytosolic carboxypeptidase 1, Nervous system nuclear protein induced by axotomy protein 1 homolog, Nna1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
23287
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit