Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AHCYL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | AHCYL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157654
|
Novus Biologicals
NBP157654 |
100 μL |
Each for $436.00
|
|
NBP15765420
|
Novus Biologicals
NBP15765420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
AHCYL1 Polyclonal specifically detects AHCYL1 in Human samples. It is validated for Western Blot.Specifications
| AHCYL1 | |
| Polyclonal | |
| Rabbit | |
| O43865 | |
| 10768 | |
| Synthetic peptides corresponding to AHCYL1(S-adenosylhomocysteine hydrolase-like 1) The peptide sequence was selected from the N terminal of AHCYL1. Peptide sequence TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| adenosylhomocysteinase-like 1, AdoHcyase 2, DCAL, DC-expressed AHCY-like molecule, dendritic cell expressed AHCY-like protein, inositol 14,5-trisphosphate receptor-binding protein, IRBIT, PRO0233, putative adenosylhomocysteinase 2, S-adenosyl homocysteine hydrolase homolog, S-adenosylhomocysteine hydrolase-like 1, S-adenosylhomocysteine hydrolase-like protein 1, S-adenosyl-L-homocysteine hydrolase 2, XPVKONAEC 3.3.1.1 | |
| AHCYL1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title