Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AHRR Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310508100UL
Description
AHRR Polyclonal specifically detects AHRR in Human samples. It is validated for Western Blot.Specifications
AHRR | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
AHH, AHHR, AhR repressor, AhRR, aryl hydrocarbon receptor regulator, aryl hydrocarbon receptor repressor, arylhydrocarbon receptor repressor, aryl-hydrocarbon receptor repressor, BHLHE77, Class E basic helix-loop-helix protein 77, dioxin receptor repressor, KIAA1234bHLHe77aryl hydrocarbon hydroxylase regulator, MGC167813, MGC176630 | |
The immunogen is a synthetic peptide directed towards the middle region of human AHRR (NP_065782). Peptide sequence LPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVP | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
57491 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction