Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AIBZIP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen AIBZIP
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126561
View Documents
Novus Biologicals
NBP310830100UL
100 μg
Each for $352.89
Add to cart
 
NB126562
View Documents
Novus Biologicals
NBP31083025UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

AIBZIP Polyclonal antibody specifically detects AIBZIP in Human samples. It is validated for Western Blot
Specifications

Specifications

AIBZIP
Western Blot
Purified
RUO
Human
AIbZIP, AIBZIPcAMP-responsive element-binding protein 4, Androgen-induced basic leucine zipper protein, ATCE1JAL, Attaching to CRE-like 1, cAMP responsive element binding protein 1, cAMP responsive element binding protein 3-like 4, CREB3, CREB4CREB-4, cyclic AMP-responsive element-binding protein 3-like protein 4, Cyclic AMP-responsive element-binding protein 4, hJALcAMP-responsive element-binding protein 3-like protein 4, Tisp40, Transcript induced in spermiogenesis protein 40
The immunogen is a synthetic peptide directed towards the middle region of human AIBZIP (NP_001242907.1). Peptide sequence HLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQN
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Neuroscience
PBS buffer, 2% sucrose
148327
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit