Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AICDA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$104.00 - $345.50

Specifications

Antigen AICDA
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB120100
View Documents
Novus Biologicals
NBP31097625UL
25 μg
Each for $104.00
Add to cart
 
NB120099
View Documents
Novus Biologicals
NBP310976100UL
100 μg
Each for $345.50
Add to cart
 
Description

Description

AICDA Polyclonal antibody specifically detects AICDA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

AICDA
Immunohistochemistry, Immunohistochemistry (Paraffin)
Purified
RUO
Human
activation-induced cytidine deaminase, AIDCytidine aminohydrolase, ARP2, CDA2, HIGM2EC 3.5.4.5, integrated into Burkitt's lymphoma cell line Ramos
The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT (NP_065712). Peptide sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Immunohistochemistry, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
DNA Repair, Epigenetics, Immunology, Lipid and Metabolism
PBS buffer, 2% sucrose
57379
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit