Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Airway Trypsin-like Protease/HAT/TMPRSS11D Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $299.00
Specifications
| Antigen | Airway Trypsin-like Protease/HAT/TMPRSS11D |
|---|---|
| Immunogen | Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the N terminal of TMPRSS11D. Peptide sequence RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16254520 |
Novus Biologicals
NBP16254520UL |
20ul |
Each for $149.00
|
|
NBP162545 |
Novus Biologicals
NBP162545 |
100ul |
Each for $299.00
|
|
Description
Airway Trypsin-like Protease/HAT/TMPRSS11D Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.Specifications
| Airway Trypsin-like Protease/HAT/TMPRSS11D | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 9407 | |
| Purified | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| RUO |
| Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the N terminal of TMPRSS11D. Peptide sequence RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA. | |
| Primary | |
| IgG | |
| airway trypsin like protease, Airway trypsin-like protease, EC 3.4.21, EC 3.4.21.-, HAT, MGC150587, MGC150588, transmembrane protease serine 11D, transmembrane protease, serine 11D | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Protein A purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title