Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Airway Trypsin-like Protease/HAT/TMPRSS11D Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Airway Trypsin-like Protease/HAT/TMPRSS11D |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16254520
|
Novus Biologicals
NBP16254520UL |
20 μL |
Each for $152.22
|
|
NBP162545
|
Novus Biologicals
NBP162545 |
100 μL |
Each for $436.00
|
|
Description
Airway Trypsin-like Protease/HAT/TMPRSS11D Polyclonal specifically detects Airway Trypsin-like Protease/HAT/TMPRSS11D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Airway Trypsin-like Protease/HAT/TMPRSS11D | |
Polyclonal | |
Purified | |
RUO | |
O60235 | |
9407 | |
Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the N terminal of TMPRSS11D. Peptide sequence RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
airway trypsin like protease, Airway trypsin-like protease, EC 3.4.21, EC 3.4.21.-, HAT, MGC150587, MGC150588, transmembrane protease serine 11D, transmembrane protease, serine 11D | |
TMPRSS11D | |
IgG | |
Protein A purified | |
46 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title