Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AKAP7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15311620UL

 View more versions of this product

Catalog No. NBP1531620


Add to cart

Description

Description

AKAP7 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

AKAP7
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
AKAP7
Synthetic peptides corresponding to AKAP7(A kinase (PRKA) anchor protein 7) The peptide sequence was selected from the middle region of AKAP7. Peptide sequence MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN.
37 kDa
20ul
Stem Cell Markers
Primary
9465
Western Blot
Western Blot 1:100-1:2000
Q9P0M2
A kinase (PRKA) anchor protein 7, AKAP 18, AKAP15, AKAP18A-kinase anchor protein 7 isoform alpha, AKAP-7 isoform gamma, AKAP-7 isoforms alpha and beta, A-kinase anchor protein 18 kDa, A-kinase anchor protein 7, A-kinase anchor protein 7 isoform gamma, A-kinase anchor protein 7 isoforms alpha and beta, A-kinase anchor protein 9 kDa, A-kinase anchor protein, 18-kD, A-kinase anchoring protein 18, protein kinase A anchoring protein 7, Protein kinase A-anchoring protein 7 isoform gamma, Protein kinase A-anchoring protein 7 isoforms alpha/beta
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit