Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AKAP7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | AKAP7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP153116
|
Novus Biologicals
NBP153116 |
100 μL |
Each of 1 for $436.00
|
|
Description
AKAP7 Polyclonal specifically detects AKAP7 in Human samples. It is validated for Western Blot.Specifications
AKAP7 | |
Polyclonal | |
Purified | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
A kinase (PRKA) anchor protein 7, AKAP 18, AKAP15, AKAP18A-kinase anchor protein 7 isoform alpha, AKAP-7 isoform gamma, AKAP-7 isoforms alpha and beta, A-kinase anchor protein 18 kDa, A-kinase anchor protein 7, A-kinase anchor protein 7 isoform gamma, A-kinase anchor protein 7 isoforms alpha and beta, A-kinase anchor protein 9 kDa, A-kinase anchor protein, 18-kD, A-kinase anchoring protein 18, protein kinase A anchoring protein 7, Protein kinase A-anchoring protein 7 isoform gamma, Protein kinase A-anchoring protein 7 isoforms alpha/beta | |
AKAP7 | |
IgG | |
Protein A purified | |
37 kDa |
Western Blot | |
Unconjugated | |
Rabbit | |
Stem Cell Markers | |
Q9P0M2 | |
9465 | |
Synthetic peptides corresponding to AKAP7(A kinase (PRKA) anchor protein 7) The peptide sequence was selected from the middle region of AKAP7. Peptide sequence MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title