Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALAD Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ALAD |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156507
|
Novus Biologicals
NBP156507 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ALAD Polyclonal specifically detects ALAD in Human samples. It is validated for Western Blot.Specifications
| ALAD | |
| Polyclonal | |
| Rabbit | |
| Q6ZMU0 | |
| 210 | |
| Synthetic peptides corresponding to ALAD(aminolevulinate, delta-, dehydratase) The peptide sequence was selected from the N terminal of ALAD. Peptide sequence EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ALADHEC 4.2.1.24, aminolevulinate dehydratase, aminolevulinate, delta-, dehydratase, delta-aminolevulinic acid dehydratase, PBGSMGC5057, Porphobilinogen synthase | |
| ALAD | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title