Alanyl tRNA synthetase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157136

Catalog No. NBP157136

Description

Alanyl tRNA synthetase Polyclonal specifically detects Alanyl tRNA synthetase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Alanyl tRNA synthetase
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
• Gene Accession No.: P49588
• Gene Symbols: AARS1
• Immunogen: Synthetic peptides corresponding to AARS(alanyl-tRNA synthetase) The peptide sequence was selected from the C terminal of AARS. Peptide sequence VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Rabbit: 92%; Chicken: 85%; Rat: 85%; Xenopus: 78%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: alanine tRNA ligase 1, cytoplasmic, Alanine--tRNA ligase, alanyl-tRNA synthetase, alanyl-tRNA synthetase, cytoplasmic, AlaRS, CMT2N, EC 6.1.1, EC 6.1.1.7, Renal carcinoma antigen NY-REN-42
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 16
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.