Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Alanyl tRNA synthetase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15713620UL
Description
Alanyl tRNA synthetase Polyclonal specifically detects Alanyl tRNA synthetase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Alanyl tRNA synthetase | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence | |
P49588 | |
AARS | |
Synthetic peptides corresponding to AARS(alanyl-tRNA synthetase) The peptide sequence was selected from the C terminal of AARS. Peptide sequence VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
alanine tRNA ligase 1, cytoplasmic, Alanine--tRNA ligase, alanyl-tRNA synthetase, alanyl-tRNA synthetase, cytoplasmic, AlaRS, CMT2N, EC 6.1.1, EC 6.1.1.7, Renal carcinoma antigen NY-REN-42 | |
Rabbit | |
Affinity Purified | |
RUO | |
16 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction