Alanyl tRNA synthetase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15713620UL

Catalog No. NBP15713620

Description

Alanyl tRNA synthetase Polyclonal specifically detects Alanyl tRNA synthetase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Alanyl tRNA synthetase
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: P49588
• Gene Symbols: AARS
• Immunogen: Synthetic peptides corresponding to AARS(alanyl-tRNA synthetase) The peptide sequence was selected from the C terminal of AARS. Peptide sequence VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: alanine tRNA ligase 1, cytoplasmic, Alanine--tRNA ligase, alanyl-tRNA synthetase, alanyl-tRNA synthetase, cytoplasmic, AlaRS, CMT2N, EC 6.1.1, EC 6.1.1.7, Renal carcinoma antigen NY-REN-42
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 16
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.