Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALAS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15472720UL

 View more versions of this product

Catalog No. NBP15472720


Add to cart

Description

Description

ALAS2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ALAS2
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
ALAS2
Synthetic peptides corresponding to ALAS2(aminolevulinate, delta-, synthase 2) The peptide sequence was selected from the C terminal of ALAS2. Peptide sequence PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACN.
60 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
P22557
5-aminolevulinic acid synthase 2,5-aminolevulinate synthase, erythroid-specific, mitochondrial, ALASE, ALAS-E, aminolevulinate, delta-, synthase 2, aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia), ANH1, ASBXLDPP, Delta-ALA synthase 2, delta-ALA synthetase, Delta-aminolevulinate synthase 2, EC 2.3.1.37, FLJ93603, XLSA
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
212
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit