Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALAS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ALAS2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154697
|
Novus Biologicals
NBP154697 |
100 μL |
Each of 1 for $436.00
|
|
Description
ALAS2 Polyclonal specifically detects ALAS2 in Human samples. It is validated for Western Blot.Specifications
ALAS2 | |
Polyclonal | |
Rabbit | |
P22557 | |
212 | |
Synthetic peptides corresponding to ALAS2(aminolevulinate, delta-, synthase 2) The peptide sequence was selected from the C terminal of ALAS2. Peptide sequence VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
5-aminolevulinic acid synthase 2,5-aminolevulinate synthase, erythroid-specific, mitochondrial, ALASE, ALAS-E, aminolevulinate, delta-, synthase 2, aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia), ANH1, ASBXLDPP, Delta-ALA synthase 2, delta-ALA synthetase, Delta-aminolevulinate synthase 2, EC 2.3.1.37, FLJ93603, XLSA | |
ALAS2 | |
IgG | |
Affinity Purified | |
60 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title