Alcohol dehydrogenase 4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153173

Catalog No. NBP153173

Description

alcohol dehydrogenase 4 Polyclonal specifically detects alcohol dehydrogenase 4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: alcohol dehydrogenase 4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P08319
• Gene Symbols: ADH4
• Immunogen: Synthetic peptides corresponding to ADH4(alcohol dehydrogenase 4 (class II), pi polypeptide) The peptide sequence was selected from the middle region of ADH4. Peptide sequence NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 127
• Target Species: Human, Rat, Porcine, Bovine, Canine, Rabbit
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADH-2, alcohol dehydrogenase 4, alcohol dehydrogenase 4 (class II), pi polypeptide, Alcohol dehydrogenase class II pi chain, aldehyde reductase, EC 1.1.1, EC 1.1.1.1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG