Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALDH4A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15473920UL

 View more versions of this product

Catalog No. NBP15473920


Add to cart

Description

Description

ALDH4A1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

ALDH4A1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ALDH4A1
Synthetic peptides corresponding to ALDH4A1(aldehyde dehydrogenase 4 family, member A1) The peptide sequence was selected from the N terminal of ALDH4A1. Peptide sequence QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL.
24 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Q5TF55
aldehyde dehydrogenase 4 family, member A1, Aldehyde dehydrogenase family 4 member A1, ALDH4DKFZp779M035, delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial, EC 1.5.1.12, mitochondrial delta-1-pyrroline 5-carboxylate dehydrogenase, P5C dehydrogenase, P5CD, P5CDh
Rabbit
IgG
Protein A purified
RUO
Primary
8659
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit