Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALDH4A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | ALDH4A1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154739
|
Novus Biologicals
NBP154739 |
100 μL |
Each of 1 for $436.00
|
N/A |
Description
ALDH4A1 Polyclonal specifically detects ALDH4A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ALDH4A1 | |
Polyclonal | |
Purified | |
RUO | |
Q5TF55 | |
8659 | |
Synthetic peptides corresponding to ALDH4A1(aldehyde dehydrogenase 4 family, member A1) The peptide sequence was selected from the N terminal of ALDH4A1. Peptide sequence QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
aldehyde dehydrogenase 4 family, member A1, Aldehyde dehydrogenase family 4 member A1, ALDH4DKFZp779M035, delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial, EC 1.5.1.12, mitochondrial delta-1-pyrroline 5-carboxylate dehydrogenase, P5C dehydrogenase, P5CD, P5CDh | |
ALDH4A1 | |
IgG | |
Protein A purified | |
24 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title