Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALDH9A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169138
Description
ALDH9A1 Polyclonal specifically detects ALDH9A1 in Human samples. It is validated for Western Blot.Specifications
ALDH9A1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
B9EKV4 | |
ALDH9A1 | |
Synthetic peptides corresponding to ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) The peptide sequence was selected from the C terminal of ALDH9A1. Peptide sequence MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC. | |
Affinity Purified | |
RUO | |
223 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
aldehyde dehydrogenase 9 family, member A1, Aldehyde dehydrogenase E3 isozyme, Aldehyde dehydrogenase family 9 member A1, ALDH4, ALDH7, ALDH9aldehyde dehydrogenase (NAD+), E34-trimethylaminobutyraldehyde dehydrogenase, EC 1.2.1, EC 1.2.1.19, EC 1.2.1.3, EC 1.2.1.47, EC 1.2.1.8, Gamma-aminobutyraldehyde dehydrogenase, R-aminobutyraldehyde dehydrogenase, TMABADH | |
Rabbit | |
56 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Mouse: 86%; Bovine: 86%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title