Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALDH9A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ALDH9A1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16913820
|
Novus Biologicals
NBP16913820UL |
20 μL |
Each for $152.22
|
|
NBP169138
|
Novus Biologicals
NBP169138 |
100 μL |
Each for $436.00
|
|
Description
ALDH9A1 Polyclonal specifically detects ALDH9A1 in Human samples. It is validated for Western Blot.Specifications
| ALDH9A1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| aldehyde dehydrogenase 9 family, member A1, Aldehyde dehydrogenase E3 isozyme, Aldehyde dehydrogenase family 9 member A1, ALDH4, ALDH7, ALDH9aldehyde dehydrogenase (NAD+), E34-trimethylaminobutyraldehyde dehydrogenase, EC 1.2.1, EC 1.2.1.19, EC 1.2.1.3, EC 1.2.1.47, EC 1.2.1.8, Gamma-aminobutyraldehyde dehydrogenase, R-aminobutyraldehyde dehydrogenase, TMABADH | |
| ALDH9A1 | |
| IgG | |
| Affinity Purified | |
| 56 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B9EKV4 | |
| 223 | |
| Synthetic peptides corresponding to ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) The peptide sequence was selected from the C terminal of ALDH9A1. Peptide sequence MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title