Aldo-keto Reductase 1C1/AKR1C1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168877

Catalog No. NBP168877

Description

Aldo-keto Reductase 1C1/AKR1C1 Polyclonal specifically detects Aldo-keto Reductase 1C1/AKR1C1 in Human, Monkey samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aldo-keto Reductase 1C1/AKR1C1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 20 alpha-hydroxysteroid dehydrogenase, 20-ALPHA-HSD, 20-alpha-hydroxysteroid dehydrogenase, aldo-keto reductase family 1 member C1, aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase), C9, Chlordecone reductase homolog HAKRC, DD1/DD2, DD1MGC8954, DDHH-37, dihydrodiol dehydrogenase 1, Dihydrodiol dehydrogenase 1/2, dihydrodiol dehydrogenase isoform DD1, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.112, EC 1.1.1.149,2-ALPHA-HSD, EC 1.3.1.20, HAKRCDDH1aldo-keto reductase C, HBAB, hepatic dihydrodiol dehydrogenase, High-affinity hepatic bile acid-binding protein, Indanol dehydrogenase, MBAB, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II 3-alpha-hydroxysteroid dehydrogenase
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 1645
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q04828
• Gene Symbols: AKR1C1
• Immunogen: Synthetic peptide directed towards the N terminal of human AKR1C1 (NP_001344). Peptide sequence: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Horse: 86%; Sheep: 86%.
• Target Species: Human, Monkey, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG