Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALG6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162495
Description
ALG6 Polyclonal specifically detects ALG6 in Human samples. It is validated for Western Blot.Specifications
ALG6 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
alpha-1,3-glucosyltransferase), asparagine-linked glycosylation 6 homolog (S. cerevisiae, asparagine-linked glycosylation 6 homolog (yeast, asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 6 homolog, CDG1C, dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase, dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase, EC 2.4.1, EC 2.4.1.-, Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase | |
Rabbit | |
58 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9Y672 | |
ALG6 | |
Synthetic peptides corresponding to ALG6(asparagine-linked glycosylation 6 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase)) The peptide sequence was selected from the N terminal of ALG6. Peptide sequence PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
29929 | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction