Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

ALKBH8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18047320UL

 View more versions of this product

Catalog No. NBP18047320



Description

Description

ALKBH8 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ALKBH8
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
ALKBH8
Synthetic peptide directed towards the N terminal of human ALKBH8. Peptide sequence MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG.
Immunogen affinity purified
RUO
Primary
91801
Western Blot
Western Blot 1:1000
EAW67088
ABH8MGC10235, AlkB homologue 8, alkB, alkylation repair homolog 8 (E. coli), alkylated DNA repair protein alkB homolog 8, EC 1.14.11.-, EC 2.1.1.-, FLJ38204, Probable alpha-ketoglutarate-dependent dioxygenase ABH8, S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit