Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Alpha Actinin 2 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18025420UL

 View more versions of this product

Catalog No. NBP18025420

Add to cart



Alpha Actinin 2 Polyclonal antibody specifically detects Antigen in Human, Mouse samples. It is validated for Western Blotting.


Alpha Actinin 2
PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptide directed towards the C terminal of human ACTN2. Peptide sequence IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN.
98 kDa
Store at -20C. Avoid freeze-thaw cycles.
Human, Mouse
Western Blot
Western Blot 1:1000
actinin, alpha 2, alpha-actinin skeletal muscle, Alpha-actinin skeletal muscle isoform 2, alpha-actinin-2, CMD1AA, F-actin cross-linking protein
Protein A purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit