Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Alpha Actinin 2 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$116.82 - $343.85

Specifications

Antigen Alpha Actinin 2
Immunogen Synthetic peptide directed towards the C terminal of human ACTN2. Peptide sequence IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18025420 View Documents Novus Biologicals
NBP18025420UL
20ul Each for $116.82
Add to cart
 
NBP180254 View Documents Novus Biologicals
NBP180254
100ul Each for $343.85
Add to cart
 
Description

Description

Alpha Actinin 2 Polyclonal antibody specifically detects Antigen in Human, Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

Alpha Actinin 2
Rabbit
Polyclonal
Unconjugated
88
Purified
Western Blot
RUO
Synthetic peptide directed towards the C terminal of human ACTN2. Peptide sequence IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN.
Primary
IgG
actinin, alpha 2, alpha-actinin skeletal muscle, Alpha-actinin skeletal muscle isoform 2, alpha-actinin-2, CMD1AA, F-actin cross-linking protein
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit