Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
alpha-Aminoadipate Aminotransferase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP153171
Description
alpha-Aminoadipate Aminotransferase Polyclonal specifically detects alpha-Aminoadipate Aminotransferase in Human samples. It is validated for Western Blot.Specifications
alpha-Aminoadipate Aminotransferase | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
AadAT, aminoadipate aminotransferase, EC 2.6.1.39,2-aminoadipate aminotransferase, EC 2.6.1.7,2-aminoadipate transaminase, KAT/AadAT, KAT2mitochondrial, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase II, L kynurenine/alpha aminoadipate aminotransferase | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Xenopus: 100%; Guinea pig: 100%; Human: 100%; Canine: 92%; Rabbit: 92%; Bovine: 91%; Chicken: 91%; Mouse: 91%; Rat: 91%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8N5Z0 | |
AADAT | |
Synthetic peptides corresponding to AADAT(aminoadipate aminotransferase) The peptide sequence was selected from the middle region of AADAT. Peptide sequence EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI. | |
100 μL | |
Apoptosis, Neurodegeneration, Neuroscience | |
51166 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction