Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

alpha-Aminoadipate Aminotransferase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen alpha-Aminoadipate Aminotransferase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP153171
View Documents
Novus Biologicals
NBP153171
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

alpha-Aminoadipate Aminotransferase Polyclonal specifically detects alpha-Aminoadipate Aminotransferase in Human samples. It is validated for Western Blot.
Specifications

Specifications

alpha-Aminoadipate Aminotransferase
Polyclonal
Rabbit
Apoptosis, Neurodegeneration, Neuroscience
AadAT, aminoadipate aminotransferase, EC 2.6.1.39,2-aminoadipate aminotransferase, EC 2.6.1.7,2-aminoadipate transaminase, KAT/AadAT, KAT2mitochondrial, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase II, L kynurenine/alpha aminoadipate aminotransferase
AADAT
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q8N5Z0
51166
Synthetic peptides corresponding to AADAT(aminoadipate aminotransferase) The peptide sequence was selected from the middle region of AADAT. Peptide sequence EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit