Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
alpha-Aminoadipate Aminotransferase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | alpha-Aminoadipate Aminotransferase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP153171
|
Novus Biologicals
NBP153171 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
alpha-Aminoadipate Aminotransferase Polyclonal specifically detects alpha-Aminoadipate Aminotransferase in Human samples. It is validated for Western Blot.Specifications
| alpha-Aminoadipate Aminotransferase | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Neurodegeneration, Neuroscience | |
| AadAT, aminoadipate aminotransferase, EC 2.6.1.39,2-aminoadipate aminotransferase, EC 2.6.1.7,2-aminoadipate transaminase, KAT/AadAT, KAT2mitochondrial, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase II, L kynurenine/alpha aminoadipate aminotransferase | |
| AADAT | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N5Z0 | |
| 51166 | |
| Synthetic peptides corresponding to AADAT(aminoadipate aminotransferase) The peptide sequence was selected from the middle region of AADAT. Peptide sequence EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title