alpha Desmuslin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23790925UL

Catalog No. NB404696

Description

alpha Desmuslin Polyclonal specifically detects alpha Desmuslin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: alpha Desmuslin
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: O15061
• Gene Symbols: SYNM
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MDVSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRSVISD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: desmuslin, DMNEC 1.4.99.1, EC 2.6.1.16, KIAA0353synemin beta, SYNDesmuslin, synemin, synemin alpha, synemin, intermediate filament protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23336
• Target Species: Human
• Isotype: IgG