Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

alpha-N-terminal Methyltransferase 1A/METTL11A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258554

Catalog No. NBP258554


Add to cart

Description

Description

alpha-N-terminal Methyltransferase 1A/METTL11A Polyclonal antibody specifically detects alpha-N-terminal Methyltransferase 1A/METTL11A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

alpha-N-terminal Methyltransferase 1A/METTL11A
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
AD-003, alpha N-terminal protein methyltransferase 1A, C9orf32, chromosome 9 open reading frame 32, EC 2.1.1.-, methyltransferase like 11A, Methyltransferase-like protein 11A, NRMT, N-terminal RCC1 methyltransferase, NTM1A, NTMT1, X-Pro-Lys N-terminal protein methyltransferase 1A
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
NTMT1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
Affinity purified
RUO
Primary
28989
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only