Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

alpha Tubulin 4a Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153162

 View more versions of this product

Catalog No. NBP153162

Add to cart



alpha Tubulin 4a Polyclonal antibody specifically detects alpha Tubulin 4a in Human, Mouse, Rat, Porcine, Canine, Rabbit, Sheep, Zebrafish samples. It is validated for Western Blot.


alpha Tubulin 4a
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the middle region of human alpha Tubulin 4A (NP_005991). Peptide sequence GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH.
50 kDa
100 ul
Cell Biology, Cytoskeleton Markers, Stem Cell Markers
Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
Western Blot
Western Blot 0.2-1 ug/ml
alpha 1 (testis specific), Alpha-tubulin 1, FLJ30169, H2-ALPHA, Testis-specific alpha-tubulin, TUBA1, Tubulin alpha-1 chain, tubulin alpha-4A chain, Tubulin H2-alpha, tubulin, alpha 1, tubulin, alpha 4a
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit