Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

alpha Tubulin 4a Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15316220UL

 View more versions of this product

Catalog No. NBP15316220


Add to cart

Description

Description

alpha Tubulin 4a Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

alpha Tubulin 4a
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
TUBA4A
Synthetic peptide directed towards the middle region of human alpha Tubulin 4A (NP_005991). Peptide sequence GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH.
50 kDa
20ul
Cell Biology, Cytoskeleton Markers, Stem Cell Markers
Primary
7277
Western Blot
Western Blot 0.2-1 ug/ml
P68366
alpha 1 (testis specific), Alpha-tubulin 1, FLJ30169, H2-ALPHA, Testis-specific alpha-tubulin, TUBA1, Tubulin alpha-1 chain, tubulin alpha-4A chain, Tubulin H2-alpha, tubulin, alpha 1, tubulin, alpha 4a
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit