Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALS2CR15 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ALS2CR15 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156711
|
Novus Biologicals
NBP156711 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ALS2CR15 Polyclonal specifically detects ALS2CR15 in Human samples. It is validated for Western Blot.Specifications
| ALS2CR15 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Q8NDH6 | |
| 130026 | |
| Synthetic peptides corresponding to ICA1L(islet cell autoantigen 1,69kDa-like) The peptide sequence was selected from the middle region of ICA1L. Peptide sequence PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ALS2CR14, ALS2CR15, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 14, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein, candidate 15, DKFZp434E1919, Ica69-related protein, islet cell autoantigen 1,69kDa-like, islet cell autoantigen 1-like protein, MGC138440 | |
| ICA1L | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title