Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALX3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180285

 View more versions of this product

Catalog No. NBP180285


Add to cart

Description

Description

ALX3 Polyclonal antibody specifically detects ALX3 in Human, Mouse, Rat, Bovine, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

ALX3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
ALX3
Synthetic peptide directed towards the N terminal of mouse ALX3 (NP_031467). Peptide sequence MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR.
37 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Mouse: 100%; Bovine: 92%; Rat: 92%; Human: 78%.
Bovine, Guinea Pig, Human, Mouse, Rat
Western Blot
Western Blot 2.5 ug/ml
O70137
ALX homeobox 3, aristaless-like homeobox 3, homeobox protein aristaless-like 3, MGC138212, MGC141988, Proline-rich transcription factor ALX3
Rabbit
IgG
Protein A purified
RUO
Primary
257
Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit