Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALX3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ALX3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180285
|
Novus Biologicals
NBP180285 |
100 μL |
Each for $436.00
|
|
NBP18028520
|
Novus Biologicals
NBP18028520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
ALX3 Polyclonal specifically detects ALX3 in Mouse samples. It is validated for Western Blot.Specifications
| ALX3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| O70137 | |
| 257 | |
| Synthetic peptide directed towards the N terminal of mouse ALX3 (NP_031467). Peptide sequence MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ALX homeobox 3, aristaless-like homeobox 3, homeobox protein aristaless-like 3, MGC138212, MGC141988, Proline-rich transcription factor ALX3 | |
| ALX3 | |
| IgG | |
| Protein A purified | |
| 37 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title