Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15497520UL

 View more versions of this product

Catalog No. NBP15497520


Add to cart

Description

Description

AMD1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

AMD1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
AMD1
Synthetic peptides corresponding to AMD1(adenosylmethionine decarboxylase 1) The peptide sequence was selected from the N terminal of AMD1. Peptide sequence MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV.
21 kDa
20ul
Stem Cell Markers
Primary
262
Western Blot
Western Blot 1:100-1:2000
Q5VXN4
adenosylmethionine decarboxylase 1, AdoMetDC, AMD, DKFZp313L1234, EC 4.1.1.50, S-adenosylmethionine decarboxylase 1, S-adenosylmethionine decarboxylase proenzyme, SAMDCFLJ26964
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit