Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMFR/gp78 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | AMFR/gp78 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15491620
|
Novus Biologicals
NBP15491620UL |
20 μL |
Each for $152.22
|
|
NBP154916
|
Novus Biologicals
NBP154916 |
100 μL |
Each for $436.00
|
|
Description
AMFR/gp78 Polyclonal specifically detects AMFR/gp78 in Human samples. It is validated for Western Blot.Specifications
| AMFR/gp78 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| AMF receptor, AMF receptor, isoform 1, AMF receptor, isoform 2, autocrine motility factor receptor, Autocrine motility factor receptor, isoform 2, gp78, RING finger protein 45, RNF45EC 6.3.2.- | |
| AMFR | |
| IgG | |
| Protein A purified | |
| 73 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| Q6PGR1 | |
| 267 | |
| Synthetic peptides corresponding to AMFR(autocrine motility factor receptor) The peptide sequence was selected from the C terminal of AMFR. Peptide sequence FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title