Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMIGO2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17960320UL

 View more versions of this product

Catalog No. NBP17960320


Add to cart

Description

Description

AMIGO2 Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.
Specifications

Specifications

AMIGO2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
AMIGO2
Synthetic peptide directed towards the middle region of human Amigo2The immunogen for this antibody is Amigo2. Peptide sequence FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF.
57 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Rat
Western Blot
Western Blot 1:1000
NP_877968
adhesion molecule with Ig-like domain 2, ALI1amphoterin induced gene 2, alivin 1, Alivin-1, AMIGO-2, DEGAamphoterin-induced protein 2, differentially expressed in gastric adenocarcinoma, Differentially expressed in gastric adenocarcinomas, transmembrane protein AMIGO2
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
347902
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit