Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMIGO2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179603
Description
AMIGO2 Polyclonal specifically detects AMIGO2 in Rat samples. It is validated for Western Blot.Specifications
AMIGO2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
adhesion molecule with Ig-like domain 2, ALI1amphoterin induced gene 2, alivin 1, Alivin-1, AMIGO-2, DEGAamphoterin-induced protein 2, differentially expressed in gastric adenocarcinoma, Differentially expressed in gastric adenocarcinomas, transmembrane protein AMIGO2 | |
Rabbit | |
57 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Rabbit: 85% Chicken: 76%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_877968 | |
AMIGO2 | |
Synthetic peptide directed towards the middle region of human Amigo2The immunogen for this antibody is Amigo2. Peptide sequence FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF. | |
Affinity purified | |
RUO | |
347902 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction