Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMIGO2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | AMIGO2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179603
|
Novus Biologicals
NBP179603 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
AMIGO2 Polyclonal specifically detects AMIGO2 in Rat samples. It is validated for Western Blot.Specifications
| AMIGO2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| adhesion molecule with Ig-like domain 2, ALI1amphoterin induced gene 2, alivin 1, Alivin-1, AMIGO-2, DEGAamphoterin-induced protein 2, differentially expressed in gastric adenocarcinoma, Differentially expressed in gastric adenocarcinomas, transmembrane protein AMIGO2 | |
| AMIGO2 | |
| IgG | |
| Affinity Purified | |
| 57 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_877968 | |
| 347902 | |
| Synthetic peptide directed towards the middle region of human Amigo2The immunogen for this antibody is Amigo2. Peptide sequence FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title