Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aminomethyltransferase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Aminomethyltransferase |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154766
|
Novus Biologicals
NBP154766 |
100 μL |
Each of 1 for $436.00
|
|
Description
Aminomethyltransferase Polyclonal specifically detects Aminomethyltransferase in Human samples. It is validated for Western Blot.Specifications
Aminomethyltransferase | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
aminomethyltransferase, EC 2.1.2.10, GCE, GCSTaminomethyltransferase (glycine cleavage system protein T), glycine cleavage system protein T, NKHmitochondrial | |
AMT | |
IgG | |
Affinity Purified | |
44 kDa |
Western Blot | |
Unconjugated | |
RUO | |
P48728 | |
275 | |
Synthetic peptides corresponding to AMT(aminomethyltransferase) The peptide sequence was selected from the N terminal of AMT. Peptide sequence QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title