Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMPK alpha 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | AMPK alpha 2 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15632220
|
Novus Biologicals
NBP15632220UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP156322
|
Novus Biologicals
NBP156322 |
100 μL |
Each for $482.50
|
|
|||||
Description
AMPK alpha 2 Polyclonal specifically detects AMPK alpha 2 in Human, Mouse, Rat samples. It is validated for Western Blot.Specifications
| AMPK alpha 2 | |
| Unconjugated | |
| RUO | |
| P54646 | |
| 5563 | |
| Synthetic peptide directed towards the middle region of human PRKAA2 (NP_006243). Peptide sequence: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP. | |
| Primary | |
| 62 kDa |
| Polyclonal | |
| Rabbit | |
| Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Translation Control | |
| 5'-AMP-activated protein kinase catalytic subunit alpha-2, AMPK subunit alpha-2, AMPK2, AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain, AMPK-alpha-2 chain, EC 2.7.11, EC 2.7.11.1, PRKAA, protein kinase, AMP-activated, alpha 2 catalytic subunit | |
| PRKAA2 | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha-2. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title