AMSH/STAMBP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158334

Catalog No. NBP158334

Description

AMSH/STAMBP Polyclonal specifically detects AMSH/STAMBP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AMSH/STAMBP
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95630
• Gene Symbols: STAMBP
• Immunogen: Synthetic peptides corresponding to STAMBP(STAM binding protein) The peptide sequence was selected from the N terminal of STAMBP. Peptide sequence SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 10617
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AMSHAssociated molecule with the SH3 domain of STAM, EC 3.1.2.15, EC 3.4.19.-, Endosome-associated ubiquitin isopeptidase, MGC126516, MGC126518, STAM binding protein, STAM-binding protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Mouse: 92%; Rabbit: 92%; Chicken: 84%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG