Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMSH/STAMBP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | AMSH/STAMBP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158334
|
Novus Biologicals
NBP158334 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
AMSH/STAMBP Polyclonal specifically detects AMSH/STAMBP in Human samples. It is validated for Western Blot.Specifications
| AMSH/STAMBP | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| O95630 | |
| 10617 | |
| Synthetic peptides corresponding to STAMBP(STAM binding protein) The peptide sequence was selected from the N terminal of STAMBP. Peptide sequence SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| AMSHAssociated molecule with the SH3 domain of STAM, EC 3.1.2.15, EC 3.4.19.-, Endosome-associated ubiquitin isopeptidase, MGC126516, MGC126518, STAM binding protein, STAM-binding protein | |
| STAMBP | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title