Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANGEL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP183712

View more versions of this product

Catalog No. NBP183712

$627.50 / Each of 1

Qty

Add to Cart

Description

ANGEL2 Polyclonal specifically detects ANGEL2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	ANGEL2
Classification	Polyclonal
Dilution	Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20
Gene Accession No.	Q5VTE6
Gene Symbols	ANGEL2
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:YFPDTGIPEVTTCHSRSAITVDYIFYSAEKEDVAGHPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNENNSSDHLPLLAKFRLEL
Quantity	0.1 mL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	angel homolog 2 (Drosophila), KIAA0759LFLJ12793, protein angel homolog 2
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	90806
Target Species	Human
Isotype	IgG

Product Suggestions

Provide Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Full Name

Email Address *

User Name

What type of issue did you experience with the content on the page? *

Please provide a detailed description of the issue or request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only

Spot an opportunity for improvement?

Provide Content Correction

ANGEL2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions