Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANKFY1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310700100UL

 View more versions of this product

Catalog No. NB126301


Add to cart

Description

Description

ANKFY1 Polyclonal specifically detects ANKFY1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ANKFY1
Unconjugated
PBS buffer, 2% sucrose
ANKHZN, ankyrin repeat and FYVE domain containing 1, ankyrin repeat and FYVE domain-containing protein 1, ankyrin repeat hooked to zinc finger motif, ankyrin repeats hooked to a zinc finger motif, DKFZp686M19106, KIAA1255, Rabankyrin-5, ZFYVE14
The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the N-terminal region of Human ANFY1 (XP_005256736.1). Peptide sequence TPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPNMQDSKGRTPLHVS
100 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
51479
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit