Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKFY1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310699100UL
Description
ANKFY1 Polyclonal specifically detects ANKFY1 in Human samples. It is validated for Western Blot.Specifications
ANKFY1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ANKHZN, ankyrin repeat and FYVE domain containing 1, ankyrin repeat and FYVE domain-containing protein 1, ankyrin repeat hooked to zinc finger motif, ankyrin repeats hooked to a zinc finger motif, DKFZp686M19106, KIAA1255, Rabankyrin-5, ZFYVE14 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKFY1 (NP_065791). Peptide sequence VNGTSFDENSFAARLIQRGSHTDAPDTATGKARASRRGDAGVCRRQEMAC | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
51479 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction