Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKLE2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170407
Description
ANKLE2 Polyclonal specifically detects ANKLE2 in Human samples. It is validated for Western Blot.Specifications
ANKLE2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ANKLE2 | |
Synthetic peptides corresponding to KIAA0692 The peptide sequence was selected from the middle region of KIAA0692. Peptide sequence CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG. | |
Affinity purified | |
RUO | |
23141 | |
Human | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
ankyrin repeat and LEM domain containing 2, ankyrin repeat and LEM domain-containing protein 2, FLJ22280, FLJ36132, KIAA0692, LEM domain containing 7, LEMD7 | |
Rabbit | |
104 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction