Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKMY2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257818
Description
ANKMY2 Polyclonal specifically detects ANKMY2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ANKMY2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
ankyrin repeat and MYND domain containing 2, ankyrin repeat and MYND domain-containing protein 2, DKFZP564O043, ZMYND20 | |
Rabbit | |
Affinity Purified | |
RUO | |
57037 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ANKMY2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCHQHEHGYTALMFAALSGN | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only