Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANKRD13D Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen ANKRD13D
Immunogen Synthetic peptides corresponding to ANKRD13D (ankyrin repeat domain 13 family, member D) The peptide sequence was selected from the middle region of ANKRD13D. Peptide sequence ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17040820 View Documents Novus BiologicalsSupplier Diversity Partner
NBP17040820UL
20ul Each for $149.00
Add to cart
 
NBP170408 View Documents Novus BiologicalsSupplier Diversity Partner
NBP170408
100 ul Each for $329.00
Add to cart
 
Description

Description

ANKRD13D Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ANKRD13D
Rabbit
Polyclonal
Unconjugated
338692
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to ANKRD13D (ankyrin repeat domain 13 family, member D) The peptide sequence was selected from the middle region of ANKRD13D. Peptide sequence ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE.
Primary
IgG
ankyrin repeat domain 13 family, member D, ankyrin repeat domain-containing protein 13D, MGC50828
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit