Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD13D Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ANKRD13D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179620UL
|
Novus Biologicals
NBP17961120UL |
20 μL |
Each for $152.22
|
|
NBP179611
|
Novus Biologicals
NBP179611 |
100 μL |
Each for $436.00
|
|
Description
ANKRD13D Polyclonal specifically detects ANKRD13D in Mouse samples. It is validated for Western Blot.Specifications
| ANKRD13D | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ankyrin repeat domain 13 family, member D, ankyrin repeat domain-containing protein 13D, MGC50828 | |
| ANKRD13D | |
| IgG | |
| Affinity Purified | |
| 57 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_080996 | |
| 338692 | |
| Synthetic peptide directed towards the middle region of human Ankrd13dThe immunogen for this antibody is Ankrd13d. Peptide sequence RTEHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title